Lineage for d1ktdd2 (1ktd D:1-120)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1021417Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 1021521Species Mouse (Mus musculus), I-EK [TaxId:10090] [88827] (9 PDB entries)
  8. 1021529Domain d1ktdd2: 1ktd D:1-120 [72971]
    Other proteins in same PDB: d1ktda1, d1ktda2, d1ktdb1, d1ktdc1, d1ktdc2, d1ktdd1
    contains covalently bound peptides at the N-termini of chains B and D
    complexed with nag, so4

Details for d1ktdd2

PDB Entry: 1ktd (more details), 2.4 Å

PDB Description: crystal structure of class ii mhc molecule iek bound to pigeon cytochrome c peptide
PDB Compounds: (D:) Fusion protein consisting of cytochrome C peptide, glycine rich linker, and MHC E-beta-k

SCOPe Domain Sequences for d1ktdd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktdd2 d.19.1.1 (D:1-120) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]}
aadliaylkqasakggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfyn
leenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvpr

SCOPe Domain Coordinates for d1ktdd2:

Click to download the PDB-style file with coordinates for d1ktdd2.
(The format of our PDB-style files is described here.)

Timeline for d1ktdd2: