Class b: All beta proteins [48724] (141 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (5 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (15 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein Cellular retinol-binding protein II (CRBP) [50864] (2 species) |
Species Zebrafish (Danio rerio) [TaxId:7955] [75000] (2 PDB entries) |
Domain d1kqwa_: 1kqw A: [72887] complexed with rtl |
PDB Entry: 1kqw (more details), 1.38 Å
SCOP Domain Sequences for d1kqwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kqwa_ b.60.1.2 (A:) Cellular retinol-binding protein II (CRBP) {Zebrafish (Danio rerio)} padfngtwemlsndnfedvmkaldidfatrkiavhlkqtkvivqngdkfetktlstfrny evnfvigeefdeqtkgldnrtvktlvkwdgdklvcvqkgekenrgwkqwiegdllhleih cqdkvchqvfkkkn
Timeline for d1kqwa_: