Lineage for d1kqwa_ (1kqw A:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.60: Lipocalins [50813] (1 superfamily) Superfamily b.60.1: Lipocalins [50814] (3 families) 
Family b.60.1.2: Fatty acid binding protein-like [50847] (12 proteins) 
Protein Cellular retinol-binding protein II (CRBP) [50864] (2 species) Species Zebrafish (Danio rerio) [TaxId:7955] [75000] (2 PDB entries) 
Domain d1kqwa_: 1kqw A: [72887]
Details for d1kqwa_
PDB Entry: 1kqw (more details), 1.38 Å
PDB Description: Crystal structure of holo-CRBP from zebrafish
SCOP Domain Sequences for d1kqwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kqwa_ b.60.1.2 (A:) Cellular retinol-binding protein II (CRBP) {Zebrafish (Danio rerio)}
padfngtwemlsndnfedvmkaldidfatrkiavhlkqtkvivqngdkfetktlstfrny
evnfvigeefdeqtkgldnrtvktlvkwdgdklvcvqkgekenrgwkqwiegdllhleih
cqdkvchqvfkkkn
SCOP Domain Coordinates for d1kqwa_:
Click to download the PDB-style file with coordinates for d1kqwa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kqwa_:
- d1kqwa_ is new in SCOP 1.61
- d1kqwa_ appears in SCOP 1.63
- d1kqwa_ appears in the current release, SCOPe 2.08
View in 3D