SCOP 1.75: Domain d1kqlb_: 1kql B:

Lineage for d1kqlb_ (1kql B:)

1. Root: SCOP 1.75

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.5: Tropomyosin [57997] (1 family)

5. Family h.1.5.1: Tropomyosin [57998] (1 protein)

6. Protein Tropomyosin [57999] (5 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [75697] (4 PDB entries)

8. Domain d1kqlb_: 1kql B: [72882]
   fragment fused with the yeast GCN4 leucine zipper

Details for d1kqlb_

PDB Entry: 1kql, 2.7 Å

PDB Description: crystal structure of the c-terminal region of striated muscle alpha- tropomyosin at 2.7 angstrom resolution

PDB Compounds: (B:) Fusion Protein of and striated muscle alpha-tropomyosin and the GCN4 leucine zipper

SCOP Domain Sequences for d1kqlb_:

Sequence; same for both SEQRES and ATOM records:

>d1kqlb_ h.1.5.1 (B:) Tropomyosin {Rat (Rattus norvegicus) [TaxId: 10116]}
mdkveellsknyhlenevarlkklvddledelyaqklkykaiseeldhalndmt

Timeline for d1kqlb_:

• d1kqlb_ first appeared in SCOP 1.61
  
• d1kqlb_ appears in SCOP 1.73
  
• d1kqlb_ appears in SCOPe 2.01
  
• d1kqlb_ appears in the current release, SCOPe 2.08