PDB entry 1kql

View 1kql on RCSB PDB site
Description: Crystal structure of the C-terminal region of striated muscle alpha-tropomyosin at 2.7 angstrom resolution
Class: contractile protein
Keywords: thin filament, tropomyosin, muscle regulation, coiled coil, contractile protein, four-helix bundle
Deposited on 2002-01-07, released 2002-05-29
The last revision prior to the SCOP 1.75 freeze date was dated 2002-05-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.252
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fusion Protein of and striated muscle alpha-tropomyosin and the GCN4 leucine zipper
    Species: Saccharomyces cerevisiae and Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03069 (1-24)
      • initiating met (0)
    • GB AAA42293 (25-End)
    Domains in SCOP 1.75: d1kqla_
  • Chain 'B':
    Compound: Fusion Protein of and striated muscle alpha-tropomyosin and the GCN4 leucine zipper
    Species: Saccharomyces cerevisiae and Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03069 (1-24)
      • initiating met (0)
    • GB AAA42293 (25-End)
    Domains in SCOP 1.75: d1kqlb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1kqlA (A:)
mdkveellsknyhlenevarlkklvddledelyaqklkykaiseeldhalndmtsi

    Sequence, based on observed residues (ATOM records): (download) 
    >1kqlA (A:)
mdkveellsknyhlenevarlkklvddledelyaqklkykaiseeldhalndmts

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1kqlB (B:)
mdkveellsknyhlenevarlkklvddledelyaqklkykaiseeldhalndmtsi

    Sequence, based on observed residues (ATOM records): (download) 
    >1kqlB (B:)
mdkveellsknyhlenevarlkklvddledelyaqklkykaiseeldhalndmt