Class b: All beta proteins [48724] (176 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins) forms homohexameric ring structures |
Protein Pleiotropic translational regulator Hfq [74940] (3 species) |
Species Staphylococcus aureus [TaxId:1280] [74941] (3 PDB entries) |
Domain d1kq1y_: 1kq1 Y: [72859] complexed with acy |
PDB Entry: 1kq1 (more details), 1.55 Å
SCOPe Domain Sequences for d1kq1y_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kq1y_ b.38.1.2 (Y:) Pleiotropic translational regulator Hfq {Staphylococcus aureus [TaxId: 1280]} niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv
Timeline for d1kq1y_: