SCOP 1.61: Domain d1kq1b_: 1kq1 B:

Lineage for d1kq1b_ (1kq1 B:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.38: Sm-like fold [50181] (2 superfamilies)

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (2 families)

5. Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (1 protein)

6. Protein Pleiotropic translational regulator Hfq [74940] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [74941] (2 PDB entries)

8. Domain d1kq1b_: 1kq1 B: [72849]

Details for d1kq1b_

PDB Entry: 1kq1, 1.55 Å

PDB Description: 1.55 A Crystal structure of the pleiotropic translational regulator, Hfq

SCOP Domain Sequences for d1kq1b_:

Sequence; same for both SEQRES and ATOM records:

>d1kq1b_ b.38.1.2 (B:) Pleiotropic translational regulator Hfq {Staphylococcus aureus}
niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv
e

Timeline for d1kq1b_:

• d1kq1b_ is new in SCOP 1.61
  
• d1kq1b_ appears in SCOP 1.63
  
• d1kq1b_ appears in the current release, SCOPe 2.08