| Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
| Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) ![]() |
| Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (12 proteins) |
| Protein Threonyl-tRNA synthetase (ThrRS) [55694] (1 species) |
| Species Escherichia coli [TaxId:562] [55695] (5 PDB entries) |
| Domain d1kogh2: 1kog H:242-532 [72820] Other proteins in same PDB: d1koga1, d1kogb1, d1kogc1, d1kogd1, d1koge1, d1kogf1, d1kogg1, d1kogh1 complexed with tsb, zn; mutant |
PDB Entry: 1kog (more details), 3.5 Å
SCOP Domain Sequences for d1kogh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kogh2 d.104.1.1 (H:242-532) Threonyl-tRNA synthetase (ThrRS) {Escherichia coli}
rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagf
Timeline for d1kogh2: