SCOP 1.71: Domain d1kogb1: 1kog B:533-642

Lineage for d1kogb1 (1kog B:533-642)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)

6. Protein Threonyl-tRNA synthetase (ThrRS), C-terminal domain [52962] (2 species)

7. Species Escherichia coli [TaxId:562] [52963] (5 PDB entries)

8. Domain d1kogb1: 1kog B:533-642 [72807]
   Other proteins in same PDB: d1koga2, d1kogb2, d1kogc2, d1kogd2, d1koge2, d1kogf2, d1kogg2, d1kogh2

Details for d1kogb1

PDB Entry: 1kog, 3.5 Å

PDB Description: Crystal structure of E. coli threonyl-tRNA synthetase interacting with the essential domain of its mRNA operator

SCOP Domain Sequences for d1kogb1:

Sequence; same for both SEQRES and ATOM records:

>d1kogb1 c.51.1.1 (B:533-642) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Escherichia coli}
fptwlapvqvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpy
mlvcgdkevesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee

Timeline for d1kogb1:

• d1kogb1 first appeared in SCOP 1.61
  
• d1kogb1 appears in SCOP 1.69
  
• d1kogb1 appears in SCOP 1.73
  
• d1kogb1 appears in the current release, SCOPe 2.08