![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) |
![]() | Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) ![]() |
![]() | Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins) |
![]() | Protein Threonyl-tRNA synthetase (ThrRS), C-terminal domain [52962] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [52963] (5 PDB entries) |
![]() | Domain d1kogb1: 1kog B:533-642 [72807] Other proteins in same PDB: d1koga2, d1kogb2, d1kogc2, d1kogd2, d1koge2, d1kogf2, d1kogg2, d1kogh2 |
PDB Entry: 1kog (more details), 3.5 Å
SCOP Domain Sequences for d1kogb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kogb1 c.51.1.1 (B:533-642) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Escherichia coli} fptwlapvqvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpy mlvcgdkevesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee
Timeline for d1kogb1: