Lineage for d1kofb_ (1kof B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242911Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 242912Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) (S)
    division into families based on beta-sheet topologies
  5. 244063Family c.37.1.17: Gluconate kinase [75195] (1 protein)
    similar to the nucleotide/nucleoside kinases
  6. 244064Protein Gluconate kinase [75196] (1 species)
  7. 244065Species Escherichia coli [TaxId:562] [75197] (6 PDB entries)
  8. 244077Domain d1kofb_: 1kof B: [72804]
    complexed with acp, mg

Details for d1kofb_

PDB Entry: 1kof (more details), 2.8 Å

PDB Description: crystal structure of gluconate kinase

SCOP Domain Sequences for d1kofb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kofb_ c.37.1.17 (B:) Gluconate kinase {Escherichia coli}
ttnhdhhiyvlmgvsgsgksavasevahqlhaafldgdflhprrniekmasgeplndddr
kpwlqalndaafamqrtnkvslivcsalkkhyrdllregnpnlsfiylkgdfdviesrlk
arkghffktqmlvtqfetlqepgadetdvlvvdidqplegvvastievikk

SCOP Domain Coordinates for d1kofb_:

Click to download the PDB-style file with coordinates for d1kofb_.
(The format of our PDB-style files is described here.)

Timeline for d1kofb_: