Lineage for d1ko8b_ (1ko8 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2478746Family c.37.1.17: Gluconate kinase [75195] (1 protein)
    similar to the nucleotide/nucleoside kinases
    automatically mapped to Pfam PF01202
  6. 2478747Protein Gluconate kinase [75196] (1 species)
  7. 2478748Species Escherichia coli [TaxId:562] [75197] (6 PDB entries)
  8. 2478758Domain d1ko8b_: 1ko8 B: [72802]
    complexed with 6pg, mg

Details for d1ko8b_

PDB Entry: 1ko8 (more details), 2.4 Å

PDB Description: crystal structure of gluconate kinase
PDB Compounds: (B:) Gluconate kinase

SCOPe Domain Sequences for d1ko8b_:

Sequence, based on SEQRES records: (download)

>d1ko8b_ c.37.1.17 (B:) Gluconate kinase {Escherichia coli [TaxId: 562]}
ttnhdhhiyvlmgvsgsgksavasevahqlhaafldgdflhprrniekmasgeplndddr
kpwlqalndaafamqrtnkvslivcsalkkhyrdllregnpnlsfiylkgdfdviesrlk
arkghffktqmlvtqfetlqepgadetdvlvvdidqplegvvastievikkg

Sequence, based on observed residues (ATOM records): (download)

>d1ko8b_ c.37.1.17 (B:) Gluconate kinase {Escherichia coli [TaxId: 562]}
ttnhdhhiyvlmgvsgsgksavasevahqlhaafldgdflhprrniekmasgeplndddr
kpwlqalndaafamqrtnkvslivcsalkkhyrdllregnpnlsfiylkgdfdviesrlk
hffktqmlvtqfetlqepgadetdvlvvdidqplegvvastievikkg

SCOPe Domain Coordinates for d1ko8b_:

Click to download the PDB-style file with coordinates for d1ko8b_.
(The format of our PDB-style files is described here.)

Timeline for d1ko8b_: