Lineage for d1knka_ (1knk A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 193619Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies)
  4. 193739Superfamily d.79.5: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69765] (1 family) (S)
  5. 193740Family d.79.5.1: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69766] (1 protein)
  6. 193741Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (2 species)
  7. 193742Species Escherichia coli [TaxId:562] [69768] (4 PDB entries)
  8. 193747Domain d1knka_: 1knk A: [72779]

Details for d1knka_

PDB Entry: 1knk (more details), 2.8 Å

PDB Description: Crystal Structure of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate Synthase (ispF) from E. coli involved in Mevalonate-Independent Isoprenoid Biosynthesis

SCOP Domain Sequences for d1knka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knka_ d.79.5.1 (A:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Escherichia coli}
mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl
fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl
gchmddvnvkattteklgftgrgegiaceavallik

SCOP Domain Coordinates for d1knka_:

Click to download the PDB-style file with coordinates for d1knka_.
(The format of our PDB-style files is described here.)

Timeline for d1knka_: