Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies) |
Superfamily d.79.5: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69765] (1 family) |
Family d.79.5.1: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69766] (1 protein) |
Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (2 species) |
Species Escherichia coli [TaxId:562] [69768] (4 PDB entries) |
Domain d1knja_: 1knj A: [72778] |
PDB Entry: 1knj (more details), 2.8 Å
SCOP Domain Sequences for d1knja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1knja_ d.79.5.1 (A:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Escherichia coli} mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl gchmddvnvkattteklgftgrgegiaceavallik
Timeline for d1knja_: