Lineage for d1knja_ (1knj A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 193619Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies)
  4. 193739Superfamily d.79.5: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69765] (1 family) (S)
  5. 193740Family d.79.5.1: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69766] (1 protein)
  6. 193741Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (2 species)
  7. 193742Species Escherichia coli [TaxId:562] [69768] (4 PDB entries)
  8. 193748Domain d1knja_: 1knj A: [72778]

Details for d1knja_

PDB Entry: 1knj (more details), 2.8 Å

PDB Description: co-crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase (ispf) from e. coli involved in mevalonate-independent isoprenoid biosynthesis, complexed with cmp/mecdp/mn2+

SCOP Domain Sequences for d1knja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knja_ d.79.5.1 (A:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Escherichia coli}
mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl
fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl
gchmddvnvkattteklgftgrgegiaceavallik

SCOP Domain Coordinates for d1knja_:

Click to download the PDB-style file with coordinates for d1knja_.
(The format of our PDB-style files is described here.)

Timeline for d1knja_: