Lineage for d1knga_ (1kng A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877809Protein Thioredoxin-like protein CcmG (CycY, DsbE) [75237] (2 species)
  7. 2877810Species Bradyrhizobium japonicum [TaxId:375] [75238] (1 PDB entry)
  8. 2877811Domain d1knga_: 1kng A: [72777]

Details for d1knga_

PDB Entry: 1kng (more details), 1.14 Å

PDB Description: Crystal structure of CcmG reducing oxidoreductase at 1.14 A
PDB Compounds: (A:) thiol:disulfide interchange protein cycy

SCOPe Domain Sequences for d1knga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]}
rpapqtalppleglqadnvqvpgldpaafkgkvslvnvwaswcvpchdeaplltelgkdk
rfqlvginykdaadnarrflgrygnpfgrvgvdangrasiewgvygvpetfvvgregtiv
yklvgpitpdnlrsvllpqmekal

SCOPe Domain Coordinates for d1knga_:

Click to download the PDB-style file with coordinates for d1knga_.
(The format of our PDB-style files is described here.)

Timeline for d1knga_: