SCOPe 2.08: Domain d1knda1: 1knd A:2-132

Lineage for d1knda1 (1knd A:2-132)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) [54603] (2 species)

7. Species Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId:292] [54605] (6 PDB entries)

8. Domain d1knda1: 1knd A:2-132 [72772]
   complexed with caq, fe2, tbu

Details for d1knda1

PDB Entry: 1knd, 1.9 Å

PDB Description: Crystal Structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase Complexed with Catechol under Anaerobic Condition

PDB Compounds: (A:) 2,3-dihydroxybiphenyl 1,2-dioxygenase

SCOPe Domain Sequences for d1knda1:

Sequence; same for both SEQRES and ATOM records:

>d1knda1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]}
sirslgymgfavsdvaawrsfltqklglmeagttdngdlfridsrawriavqqgevddla
fagyevadaaglaqmadklkqagiavttgdaslarrrgvtglitfadpfglpleiyygas
evfekpflpga

Timeline for d1knda1:

• d1knda1 first appeared in SCOP 1.61
  
• d1knda1 appears in SCOPe 2.07