Lineage for d1kn3a_ (1kn3 A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 370218Fold b.17: PEBP-like [49776] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 370219Superfamily b.17.1: PEBP-like [49777] (2 families) (S)
  5. 370220Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (2 proteins)
  6. 370225Protein Phosphatidylethanolamine binding protein, PEBP [49779] (3 species)
  7. 370235Species Mouse (Mus musculus), PEBP-2 [TaxId:10090] [74891] (1 PDB entry)
  8. 370236Domain d1kn3a_: 1kn3 A: [72764]

Details for d1kn3a_

PDB Entry: 1kn3 (more details), 1.8 Å

PDB Description: Murine PEBP-2 (phosphatidylethanolamine-binding protein-2)

SCOP Domain Sequences for d1kn3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kn3a_ b.17.1.1 (A:) Phosphatidylethanolamine binding protein, PEBP {Mouse (Mus musculus), PEBP-2}
smwtgplslhevdeqpqhllrvtyteaeveelgqvltptqvkhrpgsiswdgldpgklyt
liltdpdapsrkkpvyrewhhflvvnmkgndissgnvlsdyvgsgppkgtglhryvwlvy
qqdkplrcdepiltnrsgdhrgkfktaafrkkyhlgapvagtcyqaewdsyvpklykqls

SCOP Domain Coordinates for d1kn3a_:

Click to download the PDB-style file with coordinates for d1kn3a_.
(The format of our PDB-style files is described here.)

Timeline for d1kn3a_: