Lineage for d1kn3a_ (1kn3 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2369531Fold b.17: PEBP-like [49776] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2369532Superfamily b.17.1: PEBP-like [49777] (3 families) (S)
  5. 2369533Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 protein domains)
  6. 2369541Protein Phosphatidylethanolamine binding protein, PEBP [49779] (4 species)
  7. 2369552Species Mouse (Mus musculus) [TaxId:10090] [74891] (2 PDB entries)
  8. 2369554Domain d1kn3a_: 1kn3 A: [72764]

Details for d1kn3a_

PDB Entry: 1kn3 (more details), 1.8 Å

PDB Description: Murine PEBP-2 (phosphatidylethanolamine-binding protein-2)
PDB Compounds: (A:) Phosphatidylethanolamine Binding Protein-2

SCOPe Domain Sequences for d1kn3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kn3a_ b.17.1.1 (A:) Phosphatidylethanolamine binding protein, PEBP {Mouse (Mus musculus) [TaxId:10090]}
smwtgplslhevdeqpqhllrvtyteaeveelgqvltptqvkhrpgsiswdgldpgklyt
liltdpdapsrkkpvyrewhhflvvnmkgndissgnvlsdyvgsgppkgtglhryvwlvy
qqdkplrcdepiltnrsgdhrgkfktaafrkkyhlgapvagtcyqaewdsyvpklykqls

SCOPe Domain Coordinates for d1kn3a_:

Click to download the PDB-style file with coordinates for d1kn3a_.
(The format of our PDB-style files is described here.)

Timeline for d1kn3a_: