SCOP 1.69: Domain d1kmiz_: 1kmi Z:

Lineage for d1kmiz_ (1kmi Z:)

1. Root: SCOP 1.69

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.4: Antiparallel coiled-coil [58086] (16 superfamilies)
   this is not a true fold; contains at least two very long antiparallel helices

4. Superfamily h.4.11: Chemotaxis phosphatase CheZ [75708] (1 family)
   dimerizes with the formation of a 4-helical bundle

5. Family h.4.11.1: Chemotaxis phosphatase CheZ [75709] (1 protein)

6. Protein Chemotaxis phosphatase CheZ [75710] (1 species)

7. Species Escherichia coli [TaxId:562] [75711] (1 PDB entry)

8. Domain d1kmiz_: 1kmi Z: [72752]
   Other proteins in same PDB: d1kmiy_
   complexed with CheY

Details for d1kmiz_

PDB Entry: 1kmi, 2.9 Å

PDB Description: crystal structure of an e.coli chemotaxis protein, chez

SCOP Domain Sequences for d1kmiz_:

Sequence, based on SEQRES records:

>d1kmiz_ h.4.11.1 (Z:) Chemotaxis phosphatase CheZ {Escherichia coli}
sikpadehsagdiiarigsltrmlrdslrelgldqaiaeaaeaipdardrlyyvvqmtaq
aaeralnsveasqphqdqmeksakaltqrwddwfadpidladarelvtdtrqfladvpah
tsftnaqllkimmaqdfqdltgqvikrmmdviqeierqllmvllenipeqesrpkrenqs
llngpqvdtskagvvasqdqvddlldslg

Sequence, based on observed residues (ATOM records):

>d1kmiz_ h.4.11.1 (Z:) Chemotaxis phosphatase CheZ {Escherichia coli}
sikpadehsagdiiarigsltrmlrdslrelgldqaiaeaaeaipdardrlyyvvqmtaq
aaeralnsveasqphqdqmeksakaltqrwddwfadpidladarelvtdtrqfladvpah
tsftnaqllkimmaqdfqdltgqvikrmmdviqeierqllmvllsqdqvddlldslg

Timeline for d1kmiz_:

• d1kmiz_ first appeared in SCOP 1.61
  
• d1kmiz_ appears in SCOP 1.67
  
• d1kmiz_ appears in SCOP 1.71
  
• d1kmiz_ appears in the current release, SCOPe 2.08