Lineage for d1kmiz_ (1kmi Z:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3042247Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 3042368Superfamily h.4.11: Chemotaxis phosphatase CheZ [75708] (1 family) (S)
    dimerizes with the formation of a 4-helical bundle
  5. 3042369Family h.4.11.1: Chemotaxis phosphatase CheZ [75709] (1 protein)
  6. 3042370Protein Chemotaxis phosphatase CheZ [75710] (1 species)
  7. 3042371Species Escherichia coli [TaxId:562] [75711] (1 PDB entry)
  8. 3042372Domain d1kmiz_: 1kmi Z: [72752]
    Other proteins in same PDB: d1kmiy_
    complexed with CheY
    complexed with bcn, bef, mg

Details for d1kmiz_

PDB Entry: 1kmi (more details), 2.9 Å

PDB Description: crystal structure of an e.coli chemotaxis protein, chez
PDB Compounds: (Z:) Chemotaxis protein cheZ

SCOPe Domain Sequences for d1kmiz_:

Sequence, based on SEQRES records: (download)

>d1kmiz_ h.4.11.1 (Z:) Chemotaxis phosphatase CheZ {Escherichia coli [TaxId: 562]}
sikpadehsagdiiarigsltrmlrdslrelgldqaiaeaaeaipdardrlyyvvqmtaq
aaeralnsveasqphqdqmeksakaltqrwddwfadpidladarelvtdtrqfladvpah
tsftnaqllkimmaqdfqdltgqvikrmmdviqeierqllmvllenipeqesrpkrenqs
llngpqvdtskagvvasqdqvddlldslg

Sequence, based on observed residues (ATOM records): (download)

>d1kmiz_ h.4.11.1 (Z:) Chemotaxis phosphatase CheZ {Escherichia coli [TaxId: 562]}
sikpadehsagdiiarigsltrmlrdslrelgldqaiaeaaeaipdardrlyyvvqmtaq
aaeralnsveasqphqdqmeksakaltqrwddwfadpidladarelvtdtrqfladvpah
tsftnaqllkimmaqdfqdltgqvikrmmdviqeierqllmvllsqdqvddlldslg

SCOPe Domain Coordinates for d1kmiz_:

Click to download the PDB-style file with coordinates for d1kmiz_.
(The format of our PDB-style files is described here.)

Timeline for d1kmiz_: