SCOPe 2.03: Domain d1klfa2: 1klf A:122-205

Lineage for d1klfa2 (1klf A:122-205)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families)

5. Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)

6. Protein FimC [49588] (1 species)

7. Species Escherichia coli [TaxId:562] [49589] (8 PDB entries)

8. Domain d1klfa2: 1klf A:122-205 [72683]
   Other proteins in same PDB: d1klfa1, d1klfb1, d1klfb2, d1klfc1, d1klfd1, d1klfd2, d1klfe1, d1klff1, d1klff2, d1klfg1, d1klfh1, d1klfh2, d1klfi1, d1klfj1, d1klfj2, d1klfk1, d1klfl1, d1klfl2, d1klfm1, d1klfn1, d1klfn2, d1klfo1, d1klfp1, d1klfp2
   complexed with man

Details for d1klfa2

PDB Entry: 1klf, 2.79 Å

PDB Description: fimh adhesin-fimc chaperone complex with d-mannose

PDB Compounds: (A:) chaperone protein fimc

SCOPe Domain Sequences for d1klfa2:

Sequence; same for both SEQRES and ATOM records:

>d1klfa2 b.7.2.1 (A:122-205) FimC {Escherichia coli [TaxId: 562]}
lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsda
gsnityrtindygaltpkmtgvme

Timeline for d1klfa2:

• d1klfa2 first appeared in SCOP 1.61
  
• d1klfa2 appears in SCOPe 2.02
  
• d1klfa2 appears in SCOPe 2.04
  
• d1klfa2 appears in the current release, SCOPe 2.08