| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.11: PapD-like [49354] (3 families) ![]() contains PP switch between strands D and C' |
| Family b.1.11.1: Pilus chaperone [49355] (6 proteins) automatically mapped to Pfam PF00345 |
| Protein Periplasmic chaperone FimC [49358] (1 species) |
| Species Escherichia coli [TaxId:562] [49359] (8 PDB entries) |
| Domain d1klfo1: 1klf O:1-121 [72710] Other proteins in same PDB: d1klfa2, d1klfb1, d1klfb2, d1klfc2, d1klfd1, d1klfd2, d1klfe2, d1klff1, d1klff2, d1klfg2, d1klfh1, d1klfh2, d1klfi2, d1klfj1, d1klfj2, d1klfk2, d1klfl1, d1klfl2, d1klfm2, d1klfn1, d1klfn2, d1klfo2, d1klfp1, d1klfp2 complexed with man |
PDB Entry: 1klf (more details), 2.79 Å
SCOPe Domain Sequences for d1klfo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1klfo1 b.1.11.1 (O:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a
Timeline for d1klfo1:
View in 3DDomains from other chains: (mouse over for more information) d1klfa1, d1klfa2, d1klfb1, d1klfb2, d1klfc1, d1klfc2, d1klfd1, d1klfd2, d1klfe1, d1klfe2, d1klff1, d1klff2, d1klfg1, d1klfg2, d1klfh1, d1klfh2, d1klfi1, d1klfi2, d1klfj1, d1klfj2, d1klfk1, d1klfk2, d1klfl1, d1klfl2, d1klfm1, d1klfm2, d1klfn1, d1klfn2, d1klfp1, d1klfp2 |