Lineage for d1kl2b_ (1kl2 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2147847Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2148075Protein Serine hydroxymethyltransferase [53429] (6 species)
  7. 2148076Species Bacillus stearothermophilus [TaxId:1422] [75272] (39 PDB entries)
  8. 2148115Domain d1kl2b_: 1kl2 B: [72665]
    complexed with fon, gly, plp

Details for d1kl2b_

PDB Entry: 1kl2 (more details), 2.7 Å

PDB Description: Crystal Structure of Serine Hydroxymethyltransferase Complexed with Glycine and 5-formyl tetrahydrofolate
PDB Compounds: (B:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d1kl2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kl2b_ c.67.1.4 (B:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]}
mkylpqqdpqvfaaieqerkrqhakieliasenfvsravmeaqgsvltnkyaegypgrry
yggceyvdiveelarerakqlfgaehanvqphsgaqanmavyftvlehgdtvlgmnlshg
ghlthgspvnfsgvqynfvaygvdpethvidyddvrekarlhrpklivaaasaypriidf
akfreiadevgaylmvdmahiaglvaaglhpnpvpyahfvtttthktlrgprggmilcqe
qfakqidkaifpgiqggplmhviaakavafgealqddfkayakrvvdnakrlasalqneg
ftlvsggtdnhlllvdlrpqqltgktaekvldevgitvnkntipydpespfvtsgirigt
aavttrgfgleemdeiaaiiglvlknvgseqaleearqrvaaltd

SCOPe Domain Coordinates for d1kl2b_:

Click to download the PDB-style file with coordinates for d1kl2b_.
(The format of our PDB-style files is described here.)

Timeline for d1kl2b_: