Class a: All alpha proteins [46456] (171 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.3: ARID-like [46774] (1 family) contains extra helices at both N- and C-termini |
Family a.4.3.1: ARID domain [46775] (3 proteins) |
Protein Transcription regulator Adr6 (Swi1) [74672] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [74673] (2 PDB entries) |
Domain d1kkxa_: 1kkx A: [72662] |
PDB Entry: 1kkx (more details)
SCOP Domain Sequences for d1kkxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kkxa_ a.4.3.1 (A:) Transcription regulator Adr6 (Swi1) {Baker's yeast (Saccharomyces cerevisiae)} nnkqyelfmkslienckkrnmplqsipeignrkinlfylymlvqkfggadqvtrtqqwsm vaqrlqisdyqqlesiyfrillpyerhmisqegiketqakri
Timeline for d1kkxa_: