Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.91: PEP carboxykinase-like [53794] (1 superfamily) contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side |
Superfamily c.91.1: PEP carboxykinase-like [53795] (2 families) |
Family c.91.1.2: HPr kinase HprK C-terminal domain [64186] (1 protein) |
Protein HPr kinase HprK C-terminal domain [64187] (3 species) |
Species Lactobacillus casei [TaxId:1582] [64188] (4 PDB entries) |
Domain d1kkmc_: 1kkm C: [72656] Other proteins in same PDB: d1kkmh_, d1kkmi_, d1kkmj_ C-terminal domain in complex with P-Ser-HPr complexed with ca, po4 |
PDB Entry: 1kkm (more details), 2.8 Å
SCOPe Domain Sequences for d1kkmc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kkmc_ c.91.1.2 (C:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} rrsmhgvlvdiyglgvlitgdsgvgksetalelvqrghrliaddrvdvyqqdeqtivgaa ppilshlleirglgiidvmnlfgagavredttislivhlenwtpdktfdrlgsgeqtqli fdvpvpkitvpvkvgrnlaiiievaamnfraksmgydatktfeknlnhliehnee
Timeline for d1kkmc_: