SCOP 1.73: Domain d1kjqb3: 1kjq B:113-318

Lineage for d1kjqb3 (1kjq B:113-318)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (8 families)

5. Family d.142.1.2: BC ATP-binding domain-like [56067] (6 proteins)

6. Protein Glycinamide ribonucleotide transformylase PurT, domain 2 [56074] (1 species)

7. Species Escherichia coli [TaxId:562] [56075] (7 PDB entries)

8. Domain d1kjqb3: 1kjq B:113-318 [72621]
   Other proteins in same PDB: d1kjqa1, d1kjqa2, d1kjqb1, d1kjqb2
   complexed with adp, cl, edo, mg, mpo, na

Details for d1kjqb3

PDB Entry: 1kjq, 1.05 Å

PDB Description: Crystal structure of glycinamide ribonucleotide transformylase in complex with Mg-ADP

PDB Compounds: (B:) phosphoribosylglycinamide formyltransferase 2

SCOP Domain Sequences for d1kjqb3:

Sequence, based on SEQRES records:

>d1kjqb3 d.142.1.2 (B:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli [TaxId: 562]}
nregirrlaaeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsae
qlaqawkyaqqggragagrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyre
swqpqqmsplaleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtl
isqdlsefalhvraflglpvggirqy

Sequence, based on observed residues (ATOM records):

>d1kjqb3 d.142.1.2 (B:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli [TaxId: 562]}
nregirrlaaeelqlptstyrfadseslfreavadigypcivkpvmsgqtfirsaeqlaq
awkyaqqgagagrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqq
msplaleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdls
efalhvraflglpvggirqy

Timeline for d1kjqb3:

• d1kjqb3 first appeared in SCOP 1.61
  
• d1kjqb3 appears in SCOP 1.71
  
• d1kjqb3 appears in SCOP 1.75
  
• d1kjqb3 appears in the current release, SCOPe 2.08