Lineage for d1kjqb3 (1kjq B:113-318)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611545Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 611546Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (7 families) (S)
  5. 611566Family d.142.1.2: BC ATP-binding domain-like [56067] (6 proteins)
  6. 611671Protein Glycinamide ribonucleotide transformylase PurT, domain 2 [56074] (1 species)
  7. 611672Species Escherichia coli [TaxId:562] [56075] (7 PDB entries)
  8. 611674Domain d1kjqb3: 1kjq B:113-318 [72621]
    Other proteins in same PDB: d1kjqa1, d1kjqa2, d1kjqb1, d1kjqb2
    complexed with adp, cl, edo, mg, mpo, na

Details for d1kjqb3

PDB Entry: 1kjq (more details), 1.05 Å

PDB Description: Crystal structure of glycinamide ribonucleotide transformylase in complex with Mg-ADP

SCOP Domain Sequences for d1kjqb3:

Sequence, based on SEQRES records: (download)

>d1kjqb3 d.142.1.2 (B:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli}
nregirrlaaeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsae
qlaqawkyaqqggragagrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyre
swqpqqmsplaleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtl
isqdlsefalhvraflglpvggirqy

Sequence, based on observed residues (ATOM records): (download)

>d1kjqb3 d.142.1.2 (B:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli}
nregirrlaaeelqlptstyrfadseslfreavadigypcivkpvmsgqtfirsaeqlaq
awkyaqqgagagrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqq
msplaleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdls
efalhvraflglpvggirqy

SCOP Domain Coordinates for d1kjqb3:

Click to download the PDB-style file with coordinates for d1kjqb3.
(The format of our PDB-style files is described here.)

Timeline for d1kjqb3: