Lineage for d1kjja2 (1kjj A:2-112)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 985731Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 985732Superfamily c.30.1: PreATP-grasp domain [52440] (8 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 985733Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 985848Protein Glycinamide ribonucleotide transformylase PurT, N-domain [52448] (1 species)
  7. 985849Species Escherichia coli [TaxId:562] [52449] (7 PDB entries)
  8. 985858Domain d1kjja2: 1kjj A:2-112 [72608]
    Other proteins in same PDB: d1kjja1, d1kjja3, d1kjjb1, d1kjjb3
    complexed with ags, cl, mg, mpo, na

Details for d1kjja2

PDB Entry: 1kjj (more details), 1.75 Å

PDB Description: crystal structure of glycniamide ribonucleotide transformylase in complex with mg-atp-gamma-s
PDB Compounds: (A:) phosphoribosylglycinamide formyltransferase 2

SCOPe Domain Sequences for d1kjja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kjja2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]}
tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltm

SCOPe Domain Coordinates for d1kjja2:

Click to download the PDB-style file with coordinates for d1kjja2.
(The format of our PDB-style files is described here.)

Timeline for d1kjja2: