SCOP 1.63: Domain d1kj9b2: 1kj9 B:2-112

Lineage for d1kj9b2 (1kj9 B:2-112)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (5 families)
   preceeds the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.1: BC N-terminal domain-like [52441] (5 proteins)

6. Protein Glycinamide ribonucleotide transformylase PurT, N-domain [52448] (1 species)

7. Species Escherichia coli [TaxId:562] [52449] (7 PDB entries)

8. Domain d1kj9b2: 1kj9 B:2-112 [72593]
   Other proteins in same PDB: d1kj9a1, d1kj9a3, d1kj9b1, d1kj9b3
   complexed with atp, cl, edo, mg, mpo, na

Details for d1kj9b2

PDB Entry: 1kj9, 1.6 Å

PDB Description: crystal structure of purt-encoded glycinamide ribonucleotide transformylase complexed with mg-atp

SCOP Domain Sequences for d1kj9b2:

Sequence; same for both SEQRES and ATOM records:

>d1kj9b2 c.30.1.1 (B:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli}
tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltm

Timeline for d1kj9b2:

• d1kj9b2 first appeared in SCOP 1.61
  
• d1kj9b2 appears in SCOP 1.65
  
• d1kj9b2 appears in the current release, SCOPe 2.08