Lineage for d1kj8b2 (1kj8 B:2-112)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1161658Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 1161659Superfamily c.30.1: PreATP-grasp domain [52440] (8 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 1161660Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 1161775Protein Glycinamide ribonucleotide transformylase PurT, N-domain [52448] (1 species)
  7. 1161776Species Escherichia coli [TaxId:562] [52449] (7 PDB entries)
  8. 1161782Domain d1kj8b2: 1kj8 B:2-112 [72587]
    Other proteins in same PDB: d1kj8a1, d1kj8a3, d1kj8b1, d1kj8b3
    complexed with atp, cl, edo, gar, mg, mpo, na

Details for d1kj8b2

PDB Entry: 1kj8 (more details), 1.6 Å

PDB Description: crystal structure of purt-encoded glycinamide ribonucleotide transformylase in complex with mg-atp and gar
PDB Compounds: (B:) phosphoribosylglycinamide formyltransferase 2

SCOPe Domain Sequences for d1kj8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kj8b2 c.30.1.1 (B:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]}
tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltm

SCOPe Domain Coordinates for d1kj8b2:

Click to download the PDB-style file with coordinates for d1kj8b2.
(The format of our PDB-style files is described here.)

Timeline for d1kj8b2: