Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries) Uniprot P01887 |
Domain d1kj2m_: 1kj2 M: [72568] Other proteins in same PDB: d1kj2a_, d1kj2b_, d1kj2d_, d1kj2e_, d1kj2h1, d1kj2h2, d1kj2i1, d1kj2i2 complexed with nag |
PDB Entry: 1kj2 (more details), 2.71 Å
SCOPe Domain Sequences for d1kj2m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kj2m_ b.1.1.2 (M:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1kj2m_: