Lineage for d1kj2h2 (1kj2 H:1-181)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2163004Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2163005Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2163006Family d.19.1.1: MHC antigen-recognition domain [54453] (13 protein domains)
  6. 2163098Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2163502Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (47 PDB entries)
    Uniprot P01901 22-299
  8. 2163545Domain d1kj2h2: 1kj2 H:1-181 [72564]
    Other proteins in same PDB: d1kj2a_, d1kj2b_, d1kj2d_, d1kj2e_, d1kj2h1, d1kj2i1, d1kj2l_, d1kj2m_
    complexed with nag

Details for d1kj2h2

PDB Entry: 1kj2 (more details), 2.71 Å

PDB Description: Murine Alloreactive ScFv TCR-Peptide-MHC Class I Molecule Complex
PDB Compounds: (H:) Allogeneic H-2Kb MHC Class I Molecule

SCOPe Domain Sequences for d1kj2h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kj2h2 d.19.1.1 (H:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOPe Domain Coordinates for d1kj2h2:

Click to download the PDB-style file with coordinates for d1kj2h2.
(The format of our PDB-style files is described here.)

Timeline for d1kj2h2: