SCOPe 2.04: Domain d1kiya_: 1kiy A:

Lineage for d1kiya_ (1kiy A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.5: Trichodiene synthase [69113] (1 protein)
   automatically mapped to Pfam PF06330

6. Protein Trichodiene synthase [69114] (1 species)

7. Species Fusarium sporotrichioides [TaxId:5514] [69115] (20 PDB entries)

8. Domain d1kiya_: 1kiy A: [72555]
   complexed with edo

Details for d1kiya_

PDB Entry: 1kiy, 2.4 Å

PDB Description: d100e trichodiene synthase

PDB Compounds: (A:) trichodiene synthase

SCOPe Domain Sequences for d1kiya_:

Sequence; same for both SEQRES and ATOM records:

>d1kiya_ a.128.1.5 (A:) Trichodiene synthase {Fusarium sporotrichioides [TaxId: 5514]}
menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp
krlqaslqtivgmvvyswakvskecmadlsihytytlvledskddpyptmvnyfddlqag
reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf
lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq
islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhl
cdrryrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanv

Timeline for d1kiya_:

• d1kiya_ first appeared in SCOP 1.61
  
• d1kiya_ appears in SCOPe 2.03
  
• d1kiya_ appears in SCOPe 2.05
  
• d1kiya_ appears in the current release, SCOPe 2.08