SCOPe 2.01: Domain d1kiuk1: 1kiu K:1-121

Lineage for d1kiuk1 (1kiu K:1-121)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (2 families)
   contains PP switch between strands D and C'

5. Family b.1.11.1: Pilus chaperone [49355] (5 proteins)

6. Protein Periplasmic chaperone FimC [49358] (1 species)

7. Species Escherichia coli [TaxId:562] [49359] (6 PDB entries)

8. Domain d1kiuk1: 1kiu K:1-121 [72543]
   Other proteins in same PDB: d1kiua2, d1kiub1, d1kiub2, d1kiuc2, d1kiud1, d1kiud2, d1kiue2, d1kiuf1, d1kiuf2, d1kiug2, d1kiuh1, d1kiuh2, d1kiui2, d1kiuj1, d1kiuj2, d1kiuk2, d1kiul1, d1kiul2, d1kium2, d1kiun1, d1kiun2, d1kiuo2, d1kiup1, d1kiup2
   complexed with mma; mutant

Details for d1kiuk1

PDB Entry: 1kiu, 3 Å

PDB Description: fimh adhesin q133n mutant-fimc chaperone complex with methyl-alpha-d- mannose

PDB Compounds: (K:) chaperone protein fimc

SCOPe Domain Sequences for d1kiuk1:

Sequence; same for both SEQRES and ATOM records:

>d1kiuk1 b.1.11.1 (K:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a

Timeline for d1kiuk1:

• d1kiuk1 first appeared in SCOP 1.61
  
• d1kiuk1 appears in SCOP 1.75
  
• d1kiuk1 appears in SCOPe 2.02
  
• d1kiuk1 appears in the current release, SCOPe 2.08