Lineage for d1kh2d2 (1kh2 D:171-395)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612334Fold d.210: Argininosuccinate synthetase, C-terminal domain [69863] (1 superfamily)
    unusual fold
  4. 2612335Superfamily d.210.1: Argininosuccinate synthetase, C-terminal domain [69864] (2 families) (S)
  5. 2612336Family d.210.1.1: Argininosuccinate synthetase, C-terminal domain [69865] (2 proteins)
  6. 2612337Protein Argininosuccinate synthetase, C-terminal domain [69866] (3 species)
  7. 2612348Species Thermus thermophilus [TaxId:274] [75594] (7 PDB entries)
  8. 2612376Domain d1kh2d2: 1kh2 D:171-395 [72472]
    Other proteins in same PDB: d1kh2a1, d1kh2b1, d1kh2c1, d1kh2d1
    complexed with atp

Details for d1kh2d2

PDB Entry: 1kh2 (more details), 2.3 Å

PDB Description: crystal structure of thermus thermophilus hb8 argininosuccinate synthetase in complex with atp
PDB Compounds: (D:) Argininosuccinate Synthetase

SCOPe Domain Sequences for d1kh2d2:

Sequence, based on SEQRES records: (download)

>d1kh2d2 d.210.1.1 (D:171-395) Argininosuccinate synthetase, C-terminal domain {Thermus thermophilus [TaxId: 274]}
pysmdanllhisyeggvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavng
erlspaallqrlneiggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltl
drevlhqrdmlspkyaelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvg
rkapkslyrqdlvsfdeaggydqkdaegfikiqalrlrvralver

Sequence, based on observed residues (ATOM records): (download)

>d1kh2d2 d.210.1.1 (D:171-395) Argininosuccinate synthetase, C-terminal domain {Thermus thermophilus [TaxId: 274]}
pysmdanllhisyeggvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavng
erlspaallqrlneiggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltl
drevlhqrdmlspkyaelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvg
rkapkslyrqdlvsgydqkdaegfikiqalrlrvralver

SCOPe Domain Coordinates for d1kh2d2:

Click to download the PDB-style file with coordinates for d1kh2d2.
(The format of our PDB-style files is described here.)

Timeline for d1kh2d2: