Lineage for d1kfyo_ (1kfy O:)

  1. Root: SCOP 1.61
  2. 201426Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 201495Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 201496Superfamily f.2.1: Membrane all-alpha [56869] (13 families) (S)
  5. 201945Family f.2.1.9: Fumarate reductase respiratory complex transmembrane subunits [56910] (1 protein)
  6. 201946Protein Fumarate reductase respiratory complex transmembrane subunits [56911] (2 species)
  7. 201947Species Escherichia coli [TaxId:562] [56912] (3 PDB entries)
  8. 201958Domain d1kfyo_: 1kfy O: [72439]
    Other proteins in same PDB: d1kfya1, d1kfya2, d1kfya3, d1kfyb1, d1kfyb2, d1kfym1, d1kfym2, d1kfym3, d1kfyn1, d1kfyn2

Details for d1kfyo_

PDB Entry: 1kfy (more details), 3.6 Å

PDB Description: quinol-fumarate reductase with quinol inhibitor 2-[1-(4-chloro-phenyl)-ethyl]-4,6-dinitro-phenol

SCOP Domain Sequences for d1kfyo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfyo_ f.2.1.9 (O:) Fumarate reductase respiratory complex transmembrane subunits {Escherichia coli}
ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv
dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat
ivilfvalyw

SCOP Domain Coordinates for d1kfyo_:

Click to download the PDB-style file with coordinates for d1kfyo_.
(The format of our PDB-style files is described here.)

Timeline for d1kfyo_: