SCOP 1.61: Domain d1ke0b_: 1ke0 B:

Lineage for d1ke0b_ (1ke0 B:)

1. Root: SCOP 1.61

2. Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)

3. Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)

4. Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (8 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (3 species)

7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (24 PDB entries)

8. Domain d1ke0b_: 1ke0 B: [72359]

Details for d1ke0b_

PDB Entry: 1ke0, 2.3 Å

PDB Description: X-ray crystal structure of AmpC beta-lactamase from E. coli in complex with the inhibitor 4-(carboxyvin-2-yl)phenylboronic acid

SCOP Domain Sequences for d1ke0b_:

Sequence; same for both SEQRES and ATOM records:

>d1ke0b_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

Timeline for d1ke0b_:

• d1ke0b_ is new in SCOP 1.61
  
• d1ke0b_ appears in SCOP 1.63
  
• d1ke0b_ appears in the current release, SCOPe 2.08