Lineage for d1kbua1 (1kbu A:18-129)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 214550Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 214807Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family) (S)
  5. 214808Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)
  6. 214809Protein Cre recombinase [47825] (1 species)
  7. 214810Species Bacteriophage P1 [TaxId:10678] [47826] (8 PDB entries)
  8. 214816Domain d1kbua1: 1kbu A:18-129 [72284]
    Other proteins in same PDB: d1kbua2, d1kbub2

Details for d1kbua1

PDB Entry: 1kbu (more details), 2.2 Å

PDB Description: cre recombinase bound to a loxp holliday junction

SCOP Domain Sequences for d1kbua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbua1 a.60.9.1 (A:18-129) Cre recombinase {Bacteriophage P1}
atsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdylly
lqarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

SCOP Domain Coordinates for d1kbua1:

Click to download the PDB-style file with coordinates for d1kbua1.
(The format of our PDB-style files is described here.)

Timeline for d1kbua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kbua2