Lineage for d1kb6a_ (1kb6 A:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 624310Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 624311Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (14 families) (S)
  5. 624325Family g.39.1.2: Nuclear receptor [57721] (12 proteins)
    duplication: two zinc-binding motifs
  6. 624390Protein Vitamin D3 receptor, VDR, DNA-binding domain [75686] (1 species)
  7. 624391Species Human (Homo sapiens) [TaxId:9606] [75687] (3 PDB entries)
  8. 624396Domain d1kb6a_: 1kb6 A: [72273]

Details for d1kb6a_

PDB Entry: 1kb6 (more details), 2.7 Å

PDB Description: Crystal Structure of VDR DNA-binding Domain Bound to Rat Osteocalcin (OC) Response Element

SCOP Domain Sequences for d1kb6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kb6a_ g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-binding domain {Human (Homo sapiens)}
pricgvcgdratgfhfnamtcegckgffrrsmkrkalftcpfngdcritkdnrrhcqacr
lkrcvdigmmkefiltdeevqrkremilkrkeee

SCOP Domain Coordinates for d1kb6a_:

Click to download the PDB-style file with coordinates for d1kb6a_.
(The format of our PDB-style files is described here.)

Timeline for d1kb6a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kb6b_