Lineage for d1kb6a_ (1kb6 A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2586757Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2586758Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2586782Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
    duplication: two zinc-binding motifs
  6. 2586855Protein Vitamin D3 receptor, VDR, DNA-binding domain [75686] (1 species)
  7. 2586856Species Human (Homo sapiens) [TaxId:9606] [75687] (4 PDB entries)
  8. 2586859Domain d1kb6a_: 1kb6 A: [72273]
    protein/DNA complex; complexed with zn

Details for d1kb6a_

PDB Entry: 1kb6 (more details), 2.7 Å

PDB Description: Crystal Structure of VDR DNA-binding Domain Bound to Rat Osteocalcin (OC) Response Element
PDB Compounds: (A:) Vitamin D3 receptor

SCOPe Domain Sequences for d1kb6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kb6a_ g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
pricgvcgdratgfhfnamtcegckgffrrsmkrkalftcpfngdcritkdnrrhcqacr
lkrcvdigmmkefiltdeevqrkremilkrkeee

SCOPe Domain Coordinates for d1kb6a_:

Click to download the PDB-style file with coordinates for d1kb6a_.
(The format of our PDB-style files is described here.)

Timeline for d1kb6a_: