Lineage for d1kamb_ (1kam B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242042Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 242043Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 242161Family c.26.1.3: Adenylyltransferase [52397] (3 proteins)
  6. 242162Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (5 species)
  7. 242173Species Bacillus subtilis [TaxId:1423] [75164] (2 PDB entries)
  8. 242175Domain d1kamb_: 1kam B: [72255]

Details for d1kamb_

PDB Entry: 1kam (more details), 2.1 Å

PDB Description: Structure of Bacillus subtilis Nicotinic Acid Mononucleotide Adenylyl Transferase

SCOP Domain Sequences for d1kamb_:

Sequence, based on SEQRES records: (download)

>d1kamb_ c.26.1.3 (B:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis}
skkigifggtfdpphnghllmanevlyqagldeiwfmpnqipphkqnedytdsfhrveml
klaiqsnpsfklelvemeregpsytfdtvsllkqrypndqlffiigadmieylpkwykld
ellnliqfigvkrpgfhvetpypllfadvpefevsstmirerfkskkptdylipdkvkky
veenglye

Sequence, based on observed residues (ATOM records): (download)

>d1kamb_ c.26.1.3 (B:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis}
skkigifggtfdpphnghllmanevlyqagldeiwfmpnqipphtdsfhrvemlklaiqs
npsfklelvemeregpsytfdtvsllkqrypndqlffiigadmieylpkwykiqfigvkr
pgfhvetpypllfadvpefevsstmirerfkskkptdylipdkvkkyveenglye

SCOP Domain Coordinates for d1kamb_:

Click to download the PDB-style file with coordinates for d1kamb_.
(The format of our PDB-style files is described here.)

Timeline for d1kamb_: