Lineage for d1k9m4_ (1k9m 4:)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 524121Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 524416Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (4 families) (S)
  5. 524460Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)
  6. 524461Protein Ribosomal protein L44e [57837] (1 species)
  7. 524462Species Archaeon Haloarcula marismortui [TaxId:2238] [57838] (18 PDB entries)
  8. 524471Domain d1k9m4_: 1k9m 4: [72211]
    Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_

Details for d1k9m4_

PDB Entry: 1k9m (more details), 3 Å

PDB Description: Co-crystal structure of tylosin bound to the 50S ribosomal subunit of Haloarcula marismortui

SCOP Domain Sequences for d1k9m4_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9m4_ g.41.8.3 (4:) Ribosomal protein L44e {Archaeon Haloarcula marismortui}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

SCOP Domain Coordinates for d1k9m4_:

Click to download the PDB-style file with coordinates for d1k9m4_.
(The format of our PDB-style files is described here.)

Timeline for d1k9m4_: