Lineage for d1k8yb_ (1k8y B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1006039Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 1006040Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 1006041Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 1006203Protein Tryptophan synthase, beta-subunit [53688] (2 species)
  7. 1006215Species Salmonella typhimurium [TaxId:90371] [53689] (37 PDB entries)
  8. 1006217Domain d1k8yb_: 1k8y B: [72184]
    Other proteins in same PDB: d1k8ya_
    complexed with 13p, na, plp; mutant

Details for d1k8yb_

PDB Entry: 1k8y (more details), 1.5 Å

PDB Description: crystal structure of the tryptophan synthase beta-ser178pro mutant complexed with d,l-alpha-glycerol-3-phosphate
PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d1k8yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8yb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwpgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdil

SCOPe Domain Coordinates for d1k8yb_:

Click to download the PDB-style file with coordinates for d1k8yb_.
(The format of our PDB-style files is described here.)

Timeline for d1k8yb_: