Lineage for d1k6lm_ (1k6l M:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1698958Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1698959Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 1698960Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1699045Protein M (medium) subunit [81481] (3 species)
  7. 1699046Species Rhodobacter sphaeroides [TaxId:1063] [81479] (60 PDB entries)
    Uniprot P02953
  8. 1699096Domain d1k6lm_: 1k6l M: [72087]
    Other proteins in same PDB: d1k6lh1, d1k6lh2, d1k6ll_
    complexed with bcl, bph, cdl, fe, lda, spn, u10

Details for d1k6lm_

PDB Entry: 1k6l (more details), 3.1 Å

PDB Description: Photosynethetic Reaction Center from Rhodobacter sphaeroides
PDB Compounds: (M:) Photosynthetic reaction center M subunit

SCOPe Domain Sequences for d1k6lm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k6lm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

SCOPe Domain Coordinates for d1k6lm_:

Click to download the PDB-style file with coordinates for d1k6lm_.
(The format of our PDB-style files is described here.)

Timeline for d1k6lm_: