Lineage for d1k4va_ (1k4v A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2149496Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2149497Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2149926Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)
    automatically mapped to Pfam PF03414
  6. 2149927Protein alpha-1,3-galactosyltransferase catalytic domain [64132] (1 species)
  7. 2149928Species Cow (Bos taurus) [TaxId:9913] [64133] (28 PDB entries)
    Uniprot P14769
  8. 2149931Domain d1k4va_: 1k4v A: [72066]
    complexed with gol, mn, udp

Details for d1k4va_

PDB Entry: 1k4v (more details), 1.53 Å

PDB Description: 1.53 A Crystal Structure of the Beta-Galactoside-alpha-1,3-galactosyltransferase in Complex with UDP
PDB Compounds: (A:) n-acetyllactosaminide alpha-1,3-galactosyltransferase

SCOPe Domain Sequences for d1k4va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4va_ c.68.1.9 (A:) alpha-1,3-galactosyltransferase catalytic domain {Cow (Bos taurus) [TaxId: 9913]}
klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie
hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdismm
rmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndftye
rrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqwhdeshln
kyfllnkptkilspeycwdyhiglpadiklvkmswqtkeynvvrnnv

SCOPe Domain Coordinates for d1k4va_:

Click to download the PDB-style file with coordinates for d1k4va_.
(The format of our PDB-style files is described here.)

Timeline for d1k4va_: