Lineage for d1k4ga_ (1k4g A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 476697Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 476698Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 proteins)
  6. 476709Protein Queosine tRNA-guanine transglycosylase [51715] (1 species)
    contains zinc-binding subdomain
  7. 476710Species Zymomonas mobilis [TaxId:542] [51716] (24 PDB entries)
  8. 476714Domain d1k4ga_: 1k4g A: [72054]

Details for d1k4ga_

PDB Entry: 1k4g (more details), 1.7 Å

PDB Description: crystal structure of trna-guanine transglycosylase (tgt) complexed with 2,6-diamino-8-(1h-imidazol-2-ylsulfanylmethyl)-3h-quinazoline-4- one

SCOP Domain Sequences for d1k4ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4ga_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis}
rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshldg
srhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrk
eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpm
lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
lkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrf
sqfaqdfraryf

SCOP Domain Coordinates for d1k4ga_:

Click to download the PDB-style file with coordinates for d1k4ga_.
(The format of our PDB-style files is described here.)

Timeline for d1k4ga_: