Lineage for d1k4ga_ (1k4g A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies) 
Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) 
Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 proteins) Protein Queosine tRNA-guanine transglycosylase [51715] (1 species) Species Zymomonas mobilis [TaxId:542] [51716] (9 PDB entries) 
Domain d1k4ga_: 1k4g A: [72054]
Details for d1k4ga_
PDB Entry: 1k4g (more details), 1.7 Å
PDB Description: crystal structure of trna-guanine transglycosylase (tgt) complexed with 2,6-diamino-8-(1h-imidazol-2-ylsulfanylmethyl)-3h-quinazoline-4- one
SCOP Domain Sequences for d1k4ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k4ga_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis}
rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshldg
srhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrk
eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpm
lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
lkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrf
sqfaqdfraryf
SCOP Domain Coordinates for d1k4ga_:
Click to download the PDB-style file with coordinates for d1k4ga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k4ga_:
- d1k4ga_ is new in SCOP 1.61
- d1k4ga_ appears in SCOP 1.63
- d1k4ga_ appears in the current release, SCOPe 2.08
View in 3D