Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (26 proteins) |
Protein Cathepsin C (dipeptidyl peptidase I), catalytic domain [75330] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [75331] (1 PDB entry) |
Domain d1k3b.1: 1k3b B:,C: [72015] Other proteins in same PDB: d1k3ba_ complexed with cl, nag, so4 |
PDB Entry: 1k3b (more details), 2.15 Å
SCOPe Domain Sequences for d1k3b.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1k3b.1 d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase I), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} lptswdwrnvhginfvspvrnqascgscysfasmgmleaririltnnsqtpilspqevvs csqyaqgceggfpyliagkyaqdfglveeacfpytgtdspckmkedcfryysseyhyvgg fyggcnealmklelvhhgpmavafevyddflhykkgiyhhtglrXdpfnpfeltnhavll vgygtdsasgmdywivknswgtgwgengyfrirrgtdecaiesiavaatpipkl
Timeline for d1k3b.1: