SCOPe 2.03: Domain d1k3b.1: 1k3b B:,C:

Lineage for d1k3b.1 (1k3b B:,C:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein Cathepsin C (dipeptidyl peptidase I), catalytic domain [75330] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75331] (1 PDB entry)

8. Domain d1k3b.1: 1k3b B:,C: [72015]
   Other proteins in same PDB: d1k3ba_
   complexed with cl, nag, so4

Details for d1k3b.1

PDB Entry: 1k3b, 2.15 Å

PDB Description: crystal structure of human dipeptidyl peptidase i (cathepsin c): exclusion domain added to an endopeptidase framework creates the machine for activation of granular serine proteases

PDB Compounds: (B:) dipeptydil-peptidase I light chain, (C:) dipeptydil-peptidase I heavy chain

SCOPe Domain Sequences for d1k3b.1:

Sequence; same for both SEQRES and ATOM records:

>g1k3b.1 d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase I), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
lptswdwrnvhginfvspvrnqascgscysfasmgmleaririltnnsqtpilspqevvs
csqyaqgceggfpyliagkyaqdfglveeacfpytgtdspckmkedcfryysseyhyvgg
fyggcnealmklelvhhgpmavafevyddflhykkgiyhhtglrXdpfnpfeltnhavll
vgygtdsasgmdywivknswgtgwgengyfrirrgtdecaiesiavaatpipkl

Timeline for d1k3b.1:

• d1k3b.1 first appeared in SCOP 1.61
  
• d1k3b.1 appears in SCOPe 2.02
  
• d1k3b.1 appears in SCOPe 2.04
  
• d1k3b.1 appears in the current release, SCOPe 2.08