PDB entry 1k3b

View 1k3b on RCSB PDB site
Description: Crystal Structure of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added to an Endopeptidase Framework Creates the Machine for Activation of Granular Serine Proteases
Class: hydrolase
Keywords: hydrolase
Deposited on 2001-10-02, released 2002-04-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.19
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptydil-peptidase I exclusion domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1k3ba_
  • Chain 'B':
    Compound: dipeptydil-peptidase I light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1k3b.1
  • Chain 'C':
    Compound: dipeptydil-peptidase I heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1k3b.1
  • Heterogens: NAG, CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k3bA (A:)
    dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
    tiiynqgfeivlndykwfaffkykeegskvttycnetmtgwvhdvlgrnwacftgkkvg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k3bB (B:)
    lptswdwrnvhginfvspvrnqascgscysfasmgmleaririltnnsqtpilspqevvs
    csqyaqgceggfpyliagkyaqdfglveeacfpytgtdspckmkedcfryysseyhyvgg
    fyggcnealmklelvhhgpmavafevyddflhykkgiyhhtglr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k3bC (C:)
    dpfnpfeltnhavllvgygtdsasgmdywivknswgtgwgengyfrirrgtdecaiesia
    vaatpipkl