Lineage for d1k12a_ (1k12 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774643Family b.18.1.15: Fucose binding lectin [74896] (1 protein)
    automatically mapped to Pfam PF00754
  6. 2774644Protein Fucose binding lectin [74897] (1 species)
  7. 2774645Species European eel (Anguilla anguilla) [TaxId:7936] [74898] (1 PDB entry)
  8. 2774646Domain d1k12a_: 1k12 A: [71978]
    complexed with ca, cl, fuc

Details for d1k12a_

PDB Entry: 1k12 (more details), 1.9 Å

PDB Description: fucose binding lectin
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d1k12a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k12a_ b.18.1.15 (A:) Fucose binding lectin {European eel (Anguilla anguilla) [TaxId: 7936]}
vipegytqenvavrgkatqsaqlrgehaanseasnaidgnrdsnfyhgscthssgqanpw
wrvdllqvytitsvtitnrgdccgerisgaeinigqhlasngvnnpecsvigsmatgetk
tfhcpapmigryvvtylptseslhlcevevnvdkpaaa

SCOPe Domain Coordinates for d1k12a_:

Click to download the PDB-style file with coordinates for d1k12a_.
(The format of our PDB-style files is described here.)

Timeline for d1k12a_: