Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.15: Fucose binding lectin [74896] (1 protein) automatically mapped to Pfam PF00754 |
Protein Fucose binding lectin [74897] (1 species) |
Species European eel (Anguilla anguilla) [TaxId:7936] [74898] (1 PDB entry) |
Domain d1k12a_: 1k12 A: [71978] complexed with ca, cl, fuc |
PDB Entry: 1k12 (more details), 1.9 Å
SCOPe Domain Sequences for d1k12a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k12a_ b.18.1.15 (A:) Fucose binding lectin {European eel (Anguilla anguilla) [TaxId: 7936]} vipegytqenvavrgkatqsaqlrgehaanseasnaidgnrdsnfyhgscthssgqanpw wrvdllqvytitsvtitnrgdccgerisgaeinigqhlasngvnnpecsvigsmatgetk tfhcpapmigryvvtylptseslhlcevevnvdkpaaa
Timeline for d1k12a_: